PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00045481001
Common NameGSBRNA2T00045481001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 310aa    MW: 33144.1 Da    PI: 9.1039
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00045481001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.85.6e-3977136362
               zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          e+alkcprC+stntkfCy+nnysl+qPr+fCk+CrryWt+GGalrnvPvGgg+r+n++++
  GSBRNA2T00045481001  77 EAALKCPRCESTNTKFCYFNNYSLTQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNRRTK 136
                          6789*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3464129IPR003851Zinc finger, Dof-type
PfamPF027013.6E-3279134IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.47880134IPR003851Zinc finger, Dof-type
PROSITE patternPS01361082118IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MVFSSIQAYL DSSNWQQAPP SNYNQSGAGA SATGGHDPGP QLQPQSQPQS NGSGSSGSIR  60
PGSMVDRARQ ANVAIPEAAL KCPRCESTNT KFCYFNNYSL TQPRHFCKTC RRYWTRGGAL  120
RNVPVGGGCR RNRRTKSSNN NNNSTVTSNN SSFSSAASGN ASTISAILSS NYGGNQESFL  180
SQILSPVRLM NTTYTTDNSM SLLNSGGLNQ DLRSIQMGNS GGSLMSCVDE WRSTSHHQQP  240
QILGGGNCEA YSNTNPSSNG FYPFESPRIT SALASQSSSV KVEDNPYKWV NVNGNCSSWT  300
DLSTFGSSR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1120133RNVPVGGGCRRNRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893070.0AC189307.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB033O04, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009141675.10.0PREDICTED: dof zinc finger protein DOF2.4-like
SwissprotO809281e-153DOF24_ARATH; Dof zinc finger protein DOF2.4
TrEMBLA0A078JFP30.0A0A078JFP3_BRANA; BnaA04g29070D protein
STRINGBra017171.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM113541732
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.11e-137DNA binding with one finger 2.4
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]